Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 1 - 2 weeks
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name STAG2 antibody
Catalog Number orb331332
Species/HostRabbit
ReactivityCanine, Equine, Human, Mouse, Porcine, Rat, Zebrafish
ConjugationUnconjugated
Tested applicationsWB
Immunogen Synthetic peptide located within the following region: LLAGGDDDTMSVISGISSRGSTVRSKKSKPSTGKRKVVEGMQLSLTEESS
Target STAG2
Alternative Names
Product Properties
Form/Appearance Liquid: supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Storage Store at 4°C for up to two weeks. For long term storage, aliquot and store at -20°C, avoid freeze/thaw cycles.
Note For research use only.
Isotype IgG
ClonalityPolyclonal
Purity Affinity Purified
MW 141 kDa
Uniprot ID Q8N3U4
NCBI NM_006603; NP_006594
Entrez 10735
Product Description

Rabbit polyclonal antibody to STAG2

Validation Images
Western blot analysis of Jurkat Whole Cell tissue using STAG2 antibody
Western blot analysis of Jurkat Whole Cell tissue using STAG2 antibody
Reviews
Write Your Own Review
You're reviewing:STAG2 antibody - orb331332
Your Rating