STAC2 Rabbit Polyclonal Antibody

SKU: orb587287

Description

Rabbit polyclonal antibody to STAC2

Research Area

Epigenetics

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human STAC2
• Target: STAC2
• Protein Sequence: Synthetic peptide located within the following region: TEMSEKENEPDDAATHSPPGTVSALQETKLQRFKRSLSLKTILRSKSLEN
• Molecular Weight: 44kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

24b2, 24b2/STAC2

Sample Type: 293T Whole cell lysates, Antibody dilution: 1.0 ug/ml.

STAC2 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb587287 with 1:200 dilution. Western blot was performed using orb587287 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: STAC2 IP with orb587287 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

Quick Database Links

Gene Symbol

STAC2

UniProt

Q6ZMT1

RefSeq (Protein):NP_945344