You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
STAC2 Rabbit Polyclonal Antibody
Catalog Number: orb587287
| Catalog Number | orb587287 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to STAC2 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human STAC2 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 44kDa |
| Target | STAC2 |
| UniProt ID | Q6ZMT1 |
| Protein Sequence | Synthetic peptide located within the following region: TEMSEKENEPDDAATHSPPGTVSALQETKLQRFKRSLSLKTILRSKSLEN |
| NCBI | NP_945344 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | 24b2, 24b2/STAC2 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Sample Type: 293T Whole cell lysates, Antibody dilution: 1.0 ug/ml.
STAC2 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb587287 with 1:200 dilution. Western blot was performed using orb587287 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: STAC2 IP with orb587287 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.
- Item 1 of 3
- Item 1 of 2
STAC2 Antibody [orb128785]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 25 μg, 100 μg, 200 μg - Item 1 of 1
Anti-STAC2 Antibody [orb215414]
WB
Human, Mouse, Primate, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 200 μl, 100 μl - Item 1 of 2
- Item 1 of 1
