Cart summary

You have no items in your shopping cart.

St6gal2 Rabbit Polyclonal Antibody (Biotin)

St6gal2 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2112172

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2112172
CategoryAntibodies
DescriptionSt6gal2 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW50kDa
UniProt IDB2RQY9
Protein SequenceSynthetic peptide located within the following region: RGLSSCAVVMSAGAILNSSLGEEIDSHDAVLRFNSAPTRGYEKDVGNKTT
NCBINP_766417
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesSt6galII, mKIAA1877, C230064G14Rik
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.