You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584662 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ST5 |
Target | ST5 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ST5 |
Protein Sequence | Synthetic peptide located within the following region: VPKPKRTFEYEADKNPKSKPSNGLPPSPTPAAPPPLPSTPAPPVTRRPKK |
UniProt ID | P78524 |
MW | 126kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | ST5, HTS1, p126 |
Note | For research use only |
NCBI | NP_005409 |
Rabbit Anti-ST5 Antibody, Catalog Number: orb584662, Formalin Fixed Paraffin Embedded Tissue: Human Heart Tissue, Observed Staining: Cytoplasm in cardiomyocytes, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-ST5 Antibody, Catalog Number: orb584662, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, nucleus, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-ST5 Antibody, Titration: 1.0 ug/ml, Positive Control: 721_B Whole Cell.