ST3GAL5 Rabbit Polyclonal Antibody

• Catalog Number: orb579772
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ST3GAL5
• Target: ST3GAL5
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Mouse, Porcine, Rabbit, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ST3GAL5
• Protein Sequence: Synthetic peptide located within the following region: DSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS
• UniProt ID: Q6NZX4
• MW: 48kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: SATI, SIAT9, SPDRS, ST3GalV, SIATGM3S, ST3Gal V
• Research Area: Cell Biology, Immunology & Inflammation, Protein B
• Note: For research use only
• NCBI: NP_003887

Positive control (+): Human Lung Tumor (T-LU), Negative control (-): 293T Cell Lysate (2T), Antibody concentration: 0.2 ug/ml.

Human kidney

WB Suggested Anti-ST3GAL5 Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate.