You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb579772 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to ST3GAL5 |
| Target | ST3GAL5 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Mouse, Porcine, Rabbit, Rat, Sheep |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ST3GAL5 |
| Protein Sequence | Synthetic peptide located within the following region: DSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS |
| UniProt ID | Q6NZX4 |
| MW | 48kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | SATI, SIAT9, SPDRS, ST3GalV, SIATGM3S, ST3Gal V |
| Research Area | Cell Biology, Immunology & Inflammation, Protein B Read more... |
| Note | For research use only |
| NCBI | NP_003887 |

Positive control (+): Human Lung Tumor (T-LU), Negative control (-): 293T Cell Lysate (2T), Antibody concentration: 0.2 ug/ml.

Human kidney

WB Suggested Anti-ST3GAL5 Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate.
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Biotin |
IHC, WB | |
Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
FITC |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review