ST3GAL4 Rabbit Polyclonal Antibody

• Catalog Number: orb579847
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ST3GAL4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ST3GAL4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 37kDa
• Target: ST3GAL4
• UniProt ID: Q6IBE6
• Protein Sequence: Synthetic peptide located within the following region: FDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDV
• NCBI: NP_006269
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: STZ, SAT3, ST-4, CGS23, SIAT4, NANTA3, SIAT4C, ST3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human Liver

Rabbit Anti-ST3GAL4 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Colon, Primary antibody Concentration: 1:200, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-ST3GAL4 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Placenta, Primary antibody Concentration: 1:200, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-ST3GAL4 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Small Intestine, Primary antibody Concentration: 1:200, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-ST3GAL4 Antibody Titration: 0.25 ug/ml, Positive Control: HepG2 cell lysate. ST3GAL4 is supported by BioGPS gene expression data to be expressed in HepG2.