You have no items in your shopping cart.
Cart summary
Item 1 of 1
SSX7 Rabbit Polyclonal Antibody
Catalog Number: orb581419
| Catalog Number | orb581419 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SSX7 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Human |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SSX7 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 21kDa |
| Target | SSX7 |
| UniProt ID | Q7RTT5 |
| Protein Sequence | Synthetic peptide located within the following region: IFPKIMPKKPAEEGNDSKGVPEASGSQNDGKHLCPPGKPSTSEKINKTSG |
| NCBI | NP_775494 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-SSX7 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Pancreas.
- Item 1 of 2
- Item 1 of 2
- Item 1 of 1
