You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576388 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SSX2 |
Target | SSX2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SSX2 |
Protein Sequence | Synthetic peptide located within the following region: HRWSSQNTHNIGRFSLSTSMGAVHGTPKTITHNRDPKGGNMPGPTDCVRE |
UniProt ID | Q16385 |
MW | 25kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | SSX, HD21, CT5.2, CT5.2A, HOM-MEL-40 |
Note | For research use only |
NCBI | NP_003138 |
Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/ml.
WB Suggested Anti-SSX2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |