You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb573919 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SSBP2 |
| Target | SSBP2 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SSBP2 |
| Protein Sequence | Synthetic peptide located within the following region: YPGGPRPPLRIPNQALGGVPGSQPLLPSGMDPTRQQGHPNMGGPMQRMTP |
| UniProt ID | P81877 |
| MW | 38kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | HSPC116, SOSS-B2 |
| Research Area | Epigenetics & Chromatin, Molecular Biology, Signal Read more... |
| Note | For research use only |
| NCBI | NP_036578 |

Colon, myenteric plexus.

IHC Information: Paraffin embedded breast tissue, tested with an antibody dilution of 5 ug/ml.

Rabbit Anti-SSBP2 antibody, Paraffin Embedded Tissue: Human Brain cell Cellular Data: Nerve fibre of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-SSBP2 Antibody, Paraffin Embedded Tissue: Human Brain, Cellular Data: Nerve fibre, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-SSBP2 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-SSBP2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:7812500, Positive Control: Raji cell lysate.
IF | |
Bovine, Canine, Equine, Gallus, Human, Mouse, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
PE |
ELISA, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Gallus, Human, Mouse, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
HRP |
IF | |
Bovine, Canine, Equine, Gallus, Human, Mouse, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Cy5.5 |
IF | |
Bovine, Canine, Equine, Gallus, Human, Mouse, Rabbit, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Cy7 |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review