You have no items in your shopping cart.
SSBP2 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SSBP2 |
| Target | SSBP2 |
| Protein Sequence | Synthetic peptide located within the following region: YPGGPRPPLRIPNQALGGVPGSQPLLPSGMDPTRQQGHPNMGGPMQRMTP |
| Molecular Weight | 38kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−SSBP2 Rabbit Polyclonal Antibody [orb215094]
IHC, WB
Bovine, Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl, 50 μlSSBP2 polyclonal antibody [orb645117]
IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μlSSBP2 Rabbit Polyclonal Antibody (Biotin) [orb2142386]
IHC, WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Rabbit
Polyclonal
Biotin
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Colon, myenteric plexus.

IHC Information: Paraffin embedded breast tissue, tested with an antibody dilution of 5 ug/ml.

Rabbit Anti-SSBP2 antibody, Paraffin Embedded Tissue: Human Brain cell Cellular Data: Nerve fibre of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-SSBP2 Antibody, Paraffin Embedded Tissue: Human Brain, Cellular Data: Nerve fibre, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-SSBP2 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-SSBP2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:7812500, Positive Control: Raji cell lysate.
Documents Download
Request a Document
Protocol Information
SSBP2 Rabbit Polyclonal Antibody (orb573919)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review


