SFRS6 Rabbit Polyclonal Antibody

• Catalog Number: orb324881
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SRSF6
• Target: SRSF6
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SFRS6
• Protein Sequence: Synthetic peptide located within the following region: KERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYS
• UniProt ID: Q13247
• MW: 40 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti B52 antibody, anti MGC5045 antibody, anti SRP
• Note: For research use only
• NCBI: NP_006266

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/mL of the antibody was used in this experiment. An isoform containing the peptide sequence is found at ~15 kDa.

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 2 ug/mL.

WB Suggested Anti-SFRS6 Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate, SRSF6 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.