Cart summary

You have no items in your shopping cart.

SRRD Rabbit Polyclonal Antibody

Catalog Number: orb580255

Select Product Size
SizePriceQuantity
100 μl$ 600.00
100 μl Enquire
DispatchUsually dispatched within 3-7 working days
Product Properties
Catalog Numberorb580255
CategoryAntibodies
DescriptionRabbit polyclonal antibody to SRRD
TargetSRRD
ClonalityPolyclonal
Species/HostRabbit
ConjugationUnconjugated
ReactivityHuman
Predicted ReactivityPorcine
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
PurificationAffinity Purified
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SRRD
Protein SequenceSynthetic peptide located within the following region: DIFNDTSVHWFPVQKLEQLSIDIWEFREEPDYQDCEDLEIIRNKREDPSA
UniProt IDQ9UH36
MW38kDa
Tested applicationsWB
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Alternative namesSRR1L, HC/HCC
NoteFor research use only
NCBINP_001013716
Images
SRRD Rabbit Polyclonal Antibody

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. SRRD is supported by BioGPS gene expression data to be expressed in 721_B.

SRRD Rabbit Polyclonal Antibody

Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. SRRD is supported by BioGPS gene expression data to be expressed in Jurkat.

SRRD Rabbit Polyclonal Antibody

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. SRRD is supported by BioGPS gene expression data to be expressed in MCF7.

SRRD Rabbit Polyclonal Antibody

WB Suggested Anti-SRRD Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.

Similar Products
Reviews

SRRD Rabbit Polyclonal Antibody (orb580255)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet