You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580255 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SRRD |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Porcine |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SRRD |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 38kDa |
Target | SRRD |
UniProt ID | Q9UH36 |
Protein Sequence | Synthetic peptide located within the following region: DIFNDTSVHWFPVQKLEQLSIDIWEFREEPDYQDCEDLEIIRNKREDPSA |
NCBI | NP_001013716 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | SRR1L, HC/HCC Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. SRRD is supported by BioGPS gene expression data to be expressed in 721_B.
Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. SRRD is supported by BioGPS gene expression data to be expressed in Jurkat.
Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. SRRD is supported by BioGPS gene expression data to be expressed in MCF7.
WB Suggested Anti-SRRD Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.