SRPRB Rabbit Polyclonal Antibody

• Catalog Number: orb330594
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SRPRB
• Target: SRPRB
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SRPRB
• Protein Sequence: Synthetic peptide located within the following region: QDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLYSSSTAPAQLGKKGKE
• UniProt ID: Q9Y5M8
• MW: 30 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti APMCF1 antibody
• Note: For research use only
• NCBI: NP_067026

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. SRPRB is supported by BioGPS gene expression data to be expressed in 721_B.

Sample Type: Hela, Antibody dilution: 1.0 ug/ml. SRPRB is supported by BioGPS gene expression data to be expressed in HeLa.

Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. SRPRB is supported by BioGPS gene expression data to be expressed in Jurkat.

Positive control (+): MCF7 Cell Lysate (N10), Negative control (-): NTERA-2 Cell Lysate (N27), Antibody concentration: 1 ug/ml.

Rabbit Anti-SRPRB Antibody, Catalog Number: orb330594, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-SRPRB Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate, SRPRB is supported by BioGPS gene expression data to be expressed in HeLa.