You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577596 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SRP19 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SRP19 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 16kDa |
Target | SRP19 |
UniProt ID | P09132 |
Protein Sequence | Synthetic peptide located within the following region: CLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKK |
NCBI | NP_003126 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Rabbit Anti-SRP19 Antibody, Catalog Number: orb577596, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-SRP19 Antibody, Catalog Number: orb577596, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-SRP19 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human Small Intestine.
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |
IHC, WB | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
FITC |