Cart summary

You have no items in your shopping cart.

SRP19 Rabbit Polyclonal Antibody (FITC)

SRP19 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2125581

DispatchUsually dispatched within 5-10 working days
$ 620.00
Catalog Numberorb2125581
CategoryAntibodies
DescriptionSRP19 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityBovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SRP19
Protein SequenceSynthetic peptide located within the following region: LCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKK
UniProt IDP09132
MW16kDa
Tested applicationsIHC, WB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
NoteFor research use only
NCBINP_003126
  • SRP19 Rabbit Polyclonal Antibody (FITC) [orb2125584]

    IHC,  WB

    Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

    Rabbit

    Polyclonal

    FITC

    100 μl