Cart summary

You have no items in your shopping cart.

    SRFBP1 Antibody - middle region : FITC

    SRFBP1 Antibody - middle region : FITC

    Catalog Number: orb2111202

    DispatchUsually dispatched within 5-10 working days
    $ 632.00
    Catalog Numberorb2111202
    CategoryAntibodies
    DescriptionSRFBP1 Antibody - middle region : FITC
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsWB
    ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SRFBP1
    Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
    ConjugationFITC
    MW39kDa
    UniProt IDQ8NEF9
    Protein SequenceSynthetic peptide located within the following region: EEFCEEEKEYFDDSTEERFYKQSSMSEDSDSGDDFFIGKVRRTRKKESSC
    NCBIEAW48899
    StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
    Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
    Alternative namesP49, Rlb1, BUD22, STRAP, p49/STRAP
    Read more...
    NoteFor research use only
    Expiration Date12 months from date of receipt.
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars