You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576219 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SREBF1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Rat |
Reactivity | Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse SREBF1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 125kDa |
Target | SREBF1 |
UniProt ID | Q9WTN3 |
Protein Sequence | Synthetic peptide located within the following region: DIEDMLQLINNQDSDFPGLFDAPYAGGETGDTGPSSPGANSPESFSSASL |
NCBI | NP_035610 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | SRE, ADD-, ADD1, SREB, SREBP, bHLHd, SREBP1, bHLHd Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-SREBF1 Antibody, Positive Control: Lane 1: 50 ug mouse glomerular endothelial lysate, Lane 2: 50 ug mouse glomerular endothelial lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:5000.
WB Suggested Anti-SREBF1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: SP2/0 cell lysate.
IF, IHC-Fr, IHC-P, WB | |
Gallus, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Equine, Goat, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IHC-P, WB | |
Hamster, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |