You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325586 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SPRY1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human SPRY1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 35kDa |
Target | SPRY1 |
UniProt ID | O43609 |
Protein Sequence | Synthetic peptide located within the following region: PTAILSLDQIKAIRGSNEYTEGPSVVKRPAPRTAPRQEKHERTHEIIPIN |
NCBI | NP_005832 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti hSPRY1 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/mL.
Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 3 ug/mL.
Positive control (+): Human stomach (ST), Negative control (-): 293T (2T), Antibody concentration: 0.5 ug/mL.
WB Suggested Anti-SPRY1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: 293T cell lysate.
ELISA, ICC, IF, IHC-Fr, IHC-P, WB | |
Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Gallus, Mouse, Porcine, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Biotin |