SPRY1 Rabbit Polyclonal Antibody

• Catalog Number: orb325586
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SPRY1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SPRY1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 35kDa
• Target: SPRY1
• UniProt ID: O43609
• Protein Sequence: Synthetic peptide located within the following region: PTAILSLDQIKAIRGSNEYTEGPSVVKRPAPRTAPRQEKHERTHEIIPIN
• NCBI: NP_005832
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti hSPRY1 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 3 ug/mL.

Positive control (+): Human stomach (ST), Negative control (-): 293T (2T), Antibody concentration: 0.5 ug/mL.

WB Suggested Anti-SPRY1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: 293T cell lysate.