You have no items in your shopping cart.
SPRED1 Rabbit Polyclonal Antibody
SKU: orb589487
Description
Research Area
Cell Biology, Molecular Biology, Signal Transduction, Stem Cell & Developmental Biology
Images & Validation
−Item 1 of 1
| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Human |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SPRED1 |
| Target | SPRED1 |
| Protein Sequence | Synthetic peptide located within the following region: IRHVSFQDEDEIVRINPRDILIRRYADYRHPDMWKNDLERDDADSSIQFS |
| Molecular Weight | 48 kDa |
| Purification | Affinity purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−LGSS, NFLS, hSpred1, spred-1, PPP1R147
Similar Products
−- Item 1 of 2
- Item 1 of 2
- Item 1 of 2
SPRED1 Antibody [orb3071987]
WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 200 μl, 100 μl, 30 μlSPRED1 Rabbit Polyclonal Antibody (HRP) [orb476943]
ELISA, IHC-Fr, IHC-P, WB
Bovine, Canine, Equine, Human, Mouse, Porcine, Rat, Sheep
Rabbit
Polyclonal
HRP
100 μl
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Sample Tissue: Human Hela Whole Cell lysates, Antibody Dilution: 1 ug/ml.
Quick Database Links
UniProt Details
− No UniProt data available
NCBI Reference Sequences
−Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product| Protein | NP_689807.1 |
|---|
Documents Download
Datasheet
Product Information
Request a Document
SPRED1 Rabbit Polyclonal Antibody (orb589487)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 3-7 working days