You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb579357 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SPPL2B |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SPPL2B |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 56kDa |
Target | SPPL2B |
UniProt ID | Q8TCT7 |
Protein Sequence | Synthetic peptide located within the following region: VARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVAL |
NCBI | NP_001070706 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | IMP4, PSH4, PSL1, IMP-4 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Human kidney
WB Suggested Anti-SPPL2B Antibody Titration: 1 ug/ml, Positive Control: Jurkat cell lysate. SPPL2B is supported by BioGPS gene expression data to be expressed in Jurkat.