You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581786 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SPATA17 |
Target | SPATA17 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Equine |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen for Anti-SPATA17 antibody is: synthetic peptide directed towards the N-terminal region of Human SPT17 |
Protein Sequence | Synthetic peptide located within the following region: ARLQARSSTVGNQYYFRNSVVDPFRKKENDAAVKIQSWFRGCQVRAYIRH |
UniProt ID | Q96L03 |
MW | 39 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | IQCH, MOT17, FAP305, MSRG11, CFAP305, MSRG-11 |
Note | For research use only |
NCBI | XP_005273109.1 |
WB Suggested Anti-SPT17 antibody Titration: 1 ug/ml, Sample Type: Human ACHN Whole Cell.
IF | |
Bovine, Canine, Equine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Cy3 |
IF | |
Bovine, Canine, Equine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Cy5.5 |
IF | |
Bovine, Canine, Equine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Cy7 |
IF | |
Bovine, Canine, Equine, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
RBITC |