SPATA17 Rabbit Polyclonal Antibody

• Catalog Number: orb581786
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SPATA17
• Target: SPATA17
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Equine
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen for Anti-SPATA17 antibody is: synthetic peptide directed towards the N-terminal region of Human SPT17
• Protein Sequence: Synthetic peptide located within the following region: ARLQARSSTVGNQYYFRNSVVDPFRKKENDAAVKIQSWFRGCQVRAYIRH
• UniProt ID: Q96L03
• MW: 39 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: IQCH, MOT17, FAP305, MSRG11, CFAP305, MSRG-11
• Note: For research use only
• NCBI: XP_005273109.1

WB Suggested Anti-SPT17 antibody Titration: 1 ug/ml, Sample Type: Human ACHN Whole Cell.