You have no items in your shopping cart.
SPATA17 Rabbit Polyclonal Antibody
SKU: orb581786
Description
Research Area
Epigenetics & Chromatin
Images & Validation
−Item 1 of 1
| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Equine |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-SPATA17 antibody is: synthetic peptide directed towards the N-terminal region of Human SPT17 |
| Target | SPATA17 |
| Protein Sequence | Synthetic peptide located within the following region: ARLQARSSTVGNQYYFRNSVVDPFRKKENDAAVKIQSWFRGCQVRAYIRH |
| Molecular Weight | 39 kDa |
| Purification | Affinity purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−IQCH, MOT17, FAP305, MSRG11, CFAP305, MSRG-11
Similar Products
−SPATA17 Antibody [orb1280988]
IHC, WB
Human
Rabbit
Polyclonal
Unconjugated
SPATA17 Antibody [orb3070922]
WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 200 μl, 100 μl, 30 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

WB Suggested Anti-SPT17 antibody Titration: 1 ug/ml, Sample Type: Human ACHN Whole Cell.
Quick Database Links
UniProt Details
− No UniProt data available
NCBI Reference Sequences
−Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product| RefSeq | XP_005273109.1 |
|---|
Documents Download
Datasheet
Product Information
Request a Document
SPATA17 Rabbit Polyclonal Antibody (orb581786)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
