You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb330931 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SPAST |
| Target | SPAST |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human SPAST |
| Protein Sequence | Synthetic peptide located within the following region: RVLVMGATNRPQELDEAVLRRFIKRVYVSLPNEETRLLLLKNLLCKQGSP |
| UniProt ID | Q9UBP0 |
| MW | 54kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | FSP2, SPG4, ADPSP |
| Research Area | Cell Biology |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |

Sample Type: MCF7 Whole Cell lysates, Antibody dilution: 1.0 ug/ml. SPAST is supported by BioGPS gene expression data to be expressed in MCF7.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Gallus, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Canine, Equine, Gallus, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
FITC |