Cart summary

You have no items in your shopping cart.

SP140L Rabbit Polyclonal Antibody (FITC)

SP140L Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2132353

DispatchUsually dispatched within 5-10 working days
$ 620.00
Catalog Numberorb2132353
CategoryAntibodies
DescriptionSP140L Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityEquine, Human, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human LOC93349
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW39kDa
UniProt IDQ9H930
Protein SequenceSynthetic peptide located within the following region: TVDFQAPLLPVTCGGVKGILHKEKLEQGTLAKCIQTEDGKWFTPMEFEIK
NCBINP_612411
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
NoteFor research use only
Expiration Date12 months from date of receipt.