SOX7 Rabbit Polyclonal Antibody

• Catalog Number: orb577233
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SOX7
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SOX7
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 42kDa
• Target: SOX7
• UniProt ID: Q9BT81
• Protein Sequence: Synthetic peptide located within the following region: LLGDMDRNEFDQYLNTPGHPDSATGAMALSGHVPVSQVTPTGPTETSLIS
• NCBI: NP_113627
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: MGC10895
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Positive control (+): Human Brain (BR), Negative control (-): HepG2 Cell Lysate (HG), Antibody concentration: 1 ug/ml.

Immunohistochemistry with Transfected 293T cell lysate tissue at an antibody concentration of 1 g/ml using anti-SOX7 antibody (orb577233).

WB Suggested Anti-SOX7 Antibody Titration: 1 ug/ml, Positive Control: Fetal Stomach cell lysate.