You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329706 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SOX6 |
Target | SOX6 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SOX6 |
Protein Sequence | Synthetic peptide located within the following region: YGMKTDGGSLAGNEMINGEDEMEMYDDYEDDPKSDYSSENEAPEAVSAN |
UniProt ID | A8MRT1 |
MW | 89kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti HSSOX6 antibody, anti SOXD antibody |
Note | For research use only |
NCBI | NP_059978 |
Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/mL.
WB Suggested Anti-SOX6 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Porcine, Rabbit, Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ChIP, IH, WB | |
Human, Mouse, Porcine, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human, Monkey, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Gallus, Human, Porcine, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |