You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb331290 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SORT1 |
Target | SORT1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: YVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLL |
UniProt ID | Q99523 |
MW | 84kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti Gp95 antibody, anti NT3 antibody |
Note | For research use only |
NCBI | NP_002950 |
Rabbit Anti-SORT1 Antibody, Catalog Number: orb331290, Formalin Fixed Paraffin Embedded Tissue: Human Heart Tissue, Observed Staining: Cytoplasm and plasma membrane in cardiomyocytes, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-SORT1 Antibody, Titration: 1.0 ug/ml, Positive Control: Hela Whole Cell.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Guinea pig, Human, Porcine | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |