You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb585643 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SOCS2 |
| Target | SOCS2 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Guinea pig, Porcine, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Protein Sequence | Synthetic peptide located within the following region: KQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHL |
| UniProt ID | O14508 |
| MW | 22kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | CIS2, SSI2, Cish2, SSI-2, SOCS-2, STATI2 |
| Research Area | Molecular Biology |
| Note | For research use only |
| NCBI | NP_003868 |
| Expiration Date | 12 months from date of receipt. |

Lanes: Lane 1: 50 ug Mouse adipose lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Donkey anti-Rabbit-HRP, Secondary Antibody dilution: 1:10000, Gene Name: SOCS2.

WB Suggested Anti-SOCS2 Antibody, Titration: 1.0 ug/ml, Positive Control: U937 Whole Cell.
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Human, Mouse, Porcine | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Canine, Equine, Human, Mouse, Porcine | |
Rat | |
Rabbit | |
Polyclonal | |
APC |
IF | |
Bovine, Canine, Equine, Human, Mouse, Porcine | |
Rat | |
Rabbit | |
Polyclonal | |
PE |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review