You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585643 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SOCS2 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Porcine, Rabbit, Rat |
Reactivity | Human, Mouse |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 22kDa |
Target | SOCS2 |
UniProt ID | O14508 |
Protein Sequence | Synthetic peptide located within the following region: KQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHL |
NCBI | NP_003868 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CIS2, SSI2, Cish2, SSI-2, SOCS-2, STATI2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Lanes: Lane 1: 50 ug Mouse adipose lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Donkey anti-Rabbit-HRP, Secondary Antibody dilution: 1:10000, Gene Name: SOCS2.
WB Suggested Anti-SOCS2 Antibody, Titration: 1.0 ug/ml, Positive Control: U937 Whole Cell.
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Mouse, Porcine | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Porcine, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |