SOCS2 Rabbit Polyclonal Antibody

• Catalog Number: orb585643
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SOCS2
• Target: SOCS2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Guinea pig, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: KQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHL
• UniProt ID: O14508
• MW: 22kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CIS2, SSI2, Cish2, SSI-2, SOCS-2, STATI2
• Research Area: Molecular Biology
• Note: For research use only
• NCBI: NP_003868
• Expiration Date: 12 months from date of receipt.

Lanes: Lane 1: 50 ug Mouse adipose lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Donkey anti-Rabbit-HRP, Secondary Antibody dilution: 1:10000, Gene Name: SOCS2.

WB Suggested Anti-SOCS2 Antibody, Titration: 1.0 ug/ml, Positive Control: U937 Whole Cell.