SNX5 antibody

• Catalog Number: orb330798
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SNX5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SNX5
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47kDa
• Target: SNX5
• UniProt ID: Q9Y5X3
• Protein Sequence: Synthetic peptide located within the following region: FVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEF
• NCBI: NP_055241
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FLJ10931 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of 293T cell lysate tissue using SNX5 antibody

Western blot analysis of human, mouse tissue using SNX5 antibody

Western blot analysis of human 293T tissue using SNX5 antibody