You have no items in your shopping cart.
Cart summary
Item 1 of 1
SNX24 Rabbit Polyclonal Antibody
Catalog Number: orb588502
Product Properties
| Catalog Number | orb588502 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SNX24 |
| Target | SNX24 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human SNX24 |
| Protein Sequence | Synthetic peptide located within the following region: LNVRHLPSLPKAESCGSFDETESEESSKLSHQPVLLFLRDPYVLPAASDF |
| UniProt ID | Q9Y343 |
| MW | 18 kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | SBBI31, PRO1284 |
| Research Area | Cell Biology |
| Note | For research use only |
| NCBI | NP_054754.1 |
Images
Sample Type: 293T Whole Cell, Antibody Dilution: 1.0 ug/ml.
Similar Products
Reviews
SNX24 Rabbit Polyclonal Antibody (orb588502)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review