SKIIP Rabbit Polyclonal Antibody

• Catalog Number: orb324413
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SNW1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SKIIP
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 61kDa
• Target: SNW1
• UniProt ID: Q13573
• Protein Sequence: Synthetic peptide located within the following region: RQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALE
• NCBI: NP_036377
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti Bx42 antibody, anti SKIP antibody, anti Prp45
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human Intestine

Rabbit Anti-SKIIP antibody, Catalog Number: orb324413, Paraffin Embedded Tissue: Human Lung cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-SKIIP Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate, SNW1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.