You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb324413 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SNW1 |
| Target | SNW1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SKIIP |
| Protein Sequence | Synthetic peptide located within the following region: RQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALE |
| UniProt ID | Q13573 |
| MW | 61kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti Bx42 antibody, anti SKIP antibody, anti Prp45 Read more... |
| Research Area | Epigenetics & Chromatin, Molecular Biology |
| Note | For research use only |
| NCBI | NP_036377 |

Human Intestine

Rabbit Anti-SKIIP antibody, Catalog Number: orb324413, Paraffin Embedded Tissue: Human Lung cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-SKIIP Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate, SNW1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.
ICC, IF | |
Bovine, Equine, Human, Mouse, Porcine, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Cy5.5 |
ICC, IF | |
Bovine, Equine, Human, Mouse, Porcine, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Cy7 |
ICC, IF | |
Bovine, Equine, Human, Mouse, Porcine, Rat, Sheep | |
Rabbit | |
Polyclonal | |
RBITC |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review