You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb577501 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SNU13 |
| Target | SNU13 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human NHP2L1 |
| Protein Sequence | Synthetic peptide located within the following region: MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGI |
| UniProt ID | P55769 |
| MW | 14kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | FA1, FA-1, NHPX, 15.5K, OTK27, SSFA1, NHP2L1, SPAG Read more... |
| Research Area | Cell Biology, Epigenetics & Chromatin, Molecular B Read more... |
| Note | For research use only |
| NCBI | NP_001003796 |
| Expiration Date | 12 months from date of receipt. |

WB Suggested Anti-NHP2L1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: OVCAR-3 cell lysate.
ICC, IF | |
Bovine, Canine, Human, Mouse, Sheep | |
Rabbit | |
Polyclonal | |
Cy5 |
ICC, IF | |
Bovine, Canine, Human, Mouse, Sheep | |
Rabbit | |
Polyclonal | |
APC |
ICC, IF | |
Bovine, Canine, Human, Mouse, Sheep | |
Rabbit | |
Polyclonal | |
Cy7 |
ICC, IF | |
Bovine, Canine, Human, Mouse, Sheep | |
Rabbit | |
Polyclonal | |
Cy5.5 |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review