SNRPD1 Rabbit Polyclonal Antibody

• Catalog Number: orb577734
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SNRPD1
• Target: SNRPD1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SNRPD1
• Protein Sequence: Synthetic peptide located within the following region: NGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFIL
• UniProt ID: P62314
• MW: 13kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: SMD1, SNRPD, Sm-D1, HsT2456
• Research Area: Epigenetics & Chromatin, Molecular Biology
• Note: For research use only
• NCBI: NP_008869

Sample Tissue: Human HepG2, Antibody Dilution: 1.0 ug/ml.

Positive control (+): HepG2 Cell Lysate (HG), Negative control (-): Human Stomach Tumor (T-ST), Antibody concentration: 1 ug/ml.

Rabbit Anti-SNRPD1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Tonsil, Primary antibody Concentration: 1:200, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-SNRPD1 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-SNRPD1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate. SNRPD1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.