SNRPA Rabbit Polyclonal Antibody

• Catalog Number: orb577644
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SNRPA
• Target: SNRPA
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SNRPA
• Protein Sequence: Synthetic peptide located within the following region: MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLK
• UniProt ID: P09012
• MW: 31kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: U1A, Mud1, U1-A
• Research Area: Cell Biology, Molecular Biology, Protein Biochemis
• Note: For research use only
• NCBI: NP_004587
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-SNRPA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Hela cell lysate. SNRPA is supported by BioGPS gene expression data to be expressed in HeLa.