EAP30 Rabbit Polyclonal Antibody

• Catalog Number: orb573836
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EAP30
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EAP30
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 29kDa
• Target: SNF8
• UniProt ID: Q96H20
• Protein Sequence: Synthetic peptide located within the following region: MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEF
• NCBI: NP_009172
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Dot3, EAP30, VPS22
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Anti-SNF8 / EAP30 antibody IHC of human heart. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. EAP30 Antibody orb573836 concentration 5 ug/ml.

Anti-SNF8 / EAP30 antibody IHC of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. EAP30 Antibody orb573836 concentration 5 ug/ml.

Rabbit Anti-EAP30 Antibody, Paraffin Embedded Tissue: Human Stomach, Cellular Data: Epithelial cells of Fundic Gland and Surface Mucous Cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-EAP30 Antibody Titration: 5.0 ug/ml, Positive Control: HepG2 cell lysate, SNF8 is supported by BioGPS gene expression data to be expressed in HepG2.