You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573836 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to EAP30 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human EAP30 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 29kDa |
Target | SNF8 |
UniProt ID | Q96H20 |
Protein Sequence | Synthetic peptide located within the following region: MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEF |
NCBI | NP_009172 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | Dot3, EAP30, VPS22 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Anti-SNF8 / EAP30 antibody IHC of human heart. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. EAP30 Antibody orb573836 concentration 5 ug/ml.
Anti-SNF8 / EAP30 antibody IHC of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. EAP30 Antibody orb573836 concentration 5 ug/ml.
Rabbit Anti-EAP30 Antibody, Paraffin Embedded Tissue: Human Stomach, Cellular Data: Epithelial cells of Fundic Gland and Surface Mucous Cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti-EAP30 Antibody Titration: 5.0 ug/ml, Positive Control: HepG2 cell lysate, SNF8 is supported by BioGPS gene expression data to be expressed in HepG2.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Bovine, Equine, Gallus, Human, Mouse, Porcine, Rabbit, Sheep | |
Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |