SNAI1 Rabbit Polyclonal Antibody

• Catalog Number: orb574602
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SNAI1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Guinea pig, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SNAI1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 29kDa
• Target: SNAI1
• UniProt ID: O95863
• Protein Sequence: Synthetic peptide located within the following region: MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEIL
• NCBI: NP_005976
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SNA, SNAH, SNAIL, SLUGH2, SNAIL1, dJ710H13.1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Spleen, Antibody dilution: 1 ug/ml.

Human kidney

Rabbit Anti-SNAI1 Antibody, Catalog Number: orb574602, Formalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-SNAI1 Antibody Titration: 1 ug/ml, Positive Control: 721_B cell lysate, SNAI1 is supported by BioGPS gene expression data to be expressed in 721_B.

WB Suggested Anti-SNAI1 antibody Titration: 1 ug/ml, Sample Type: Human 721_B.

WB Suggested Anti-SNAI1 antibody Titration: 1 ug/ml, Sample Type: Human A549.