You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb581156 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SMYD2 |
| Target | SMYD2 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SMYD2 |
| Protein Sequence | Synthetic peptide located within the following region: SMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES |
| UniProt ID | Q9NRG4 |
| MW | 50kDa |
| Tested applications | ChIP, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | KMT3C, HSKM-B, ZMYND14 |
| Research Area | Epigenetics & Chromatin |
| Note | For research use only |
| NCBI | NP_064582 |

Sample Tissue: Human 293T, Antibody dilution: 1.0 ug/ml.

Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

WB Suggested Anti-SMYD2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: SH-SYSY cell lysate. SMYD2 is supported by BioGPS gene expression data to be expressed in SHSY5Y.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Human, Porcine | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Equine, Porcine, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review