Cart summary

You have no items in your shopping cart.

Smpdl3a Rabbit Polyclonal Antibody (FITC)

Smpdl3a Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2109591

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2109591
CategoryAntibodies
DescriptionSmpdl3a Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
Protein SequenceSynthetic peptide located within the following region: YQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTGTVIKVITNMTM
UniProt IDP70158
MW49kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesAS, ASM3A, ASML3, ASML3A, AI529588, 0610010C24Rik
NoteFor research use only
NCBINP_065586