You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577488 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SMN1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Canine, Equine, Guinea pig, Porcine, Rabbit, Rat |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SMN1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 28kDa |
Target | SMN1 |
UniProt ID | Q16637 |
Protein Sequence | Synthetic peptide located within the following region: KAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKV |
NCBI | NP_075012 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | SMA, SMN, SMA1, SMA2, SMA3, SMA4, SMA@, SMNT, BCD5 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Mouse Kidney, Antibody Dilution: 1 ug/ml.
Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.
Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.
Sample Type: MCF7, Antibody Dilution: 1.0 ug/ml. SMN1 is supported by BioGPS gene expression data to be expressed in MCF7.
WB Suggested Anti-SMN1 Antibody, Titration: 0.2-1 ug/ml, Positive Control: HepG2.
FC, IF, IHC-Fr, IHC-P | |
Canine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Human, Porcine, Rabbit, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |