SMN1 Rabbit Polyclonal Antibody

• Catalog Number: orb577488
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SMN1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Equine, Guinea pig, Porcine, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SMN1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 28kDa
• Target: SMN1
• UniProt ID: Q16637
• Protein Sequence: Synthetic peptide located within the following region: KAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKV
• NCBI: NP_075012
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SMA, SMN, SMA1, SMA2, SMA3, SMA4, SMA@, SMNT, BCD5
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Kidney, Antibody Dilution: 1 ug/ml.

Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

Sample Type: MCF7, Antibody Dilution: 1.0 ug/ml. SMN1 is supported by BioGPS gene expression data to be expressed in MCF7.

WB Suggested Anti-SMN1 Antibody, Titration: 0.2-1 ug/ml, Positive Control: HepG2.