You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb588488 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SMG6 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human EST1A |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 156kDa |
Target | SMG6 |
UniProt ID | Q86US8 |
Protein Sequence | Synthetic peptide located within the following region: DEVSPTSWGDSRQAQASYYKFQNSDNPYYYPRTPGPASQYPYTGYNPLQY |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | EST1A, SMG-6, C17orf31, hSMG5/7a Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: EST1A, Sample Type: Fetal Liver lysates, Antibody Dilution: 1.0 ug/ml.
Filter by Rating