Cart summary

You have no items in your shopping cart.

    SMG6 antibody

    SMG6 antibody

    Catalog Number: orb588488

    DispatchUsually dispatched within 3-7 working days
    $ 609.00
    Catalog Numberorb588488
    CategoryAntibodies
    DescriptionRabbit polyclonal antibody to SMG6
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsWB
    Predicted ReactivityHuman
    ReactivityHuman
    ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human EST1A
    Concentration0.5 mg/ml
    Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    ConjugationUnconjugated
    MW156kDa
    TargetSMG6
    UniProt IDQ86US8
    Protein SequenceSynthetic peptide located within the following region: DEVSPTSWGDSRQAQASYYKFQNSDNPYYYPRTPGPASQYPYTGYNPLQY
    StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
    Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Alternative namesEST1A, SMG-6, C17orf31, hSMG5/7a
    Read more...
    NoteFor research use only
    Expiration Date12 months from date of receipt.
    • SMG6 antibody [orb33797]

      ELISA,  IF,  IHC

      Human

      Rabbit

      Polyclonal

      Unconjugated

      50 μg, 100 μg
    • SMG6 antibody [orb668200]

      WB

      Human, Rat

      Rabbit

      Polyclonal

      Unconjugated

      50 μl, 200 μl, 100 μl
    • SMG6 antibody (HRP) [orb33803]

      ELISA

      Human

      Rabbit

      Polyclonal

      HRP

      50 μg, 100 μg
    • SMG6 antibody (FITC) [orb33804]

      Human

      Rabbit

      Polyclonal

      FITC

      100 μg, 50 μg
    • SMG6 antibody (Biotin) [orb33807]

      ELISA

      Human

      Rabbit

      Polyclonal

      Biotin

      100 μg, 50 μg
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars