SMCO4 antibody

• Catalog Number: orb326795
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SMCO4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast
• Reactivity: Guinea pig, Human, Mouse, Rat, Yeast
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human C11orf75
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 6kDa
• Target: SMCO4
• UniProt ID: Q9NRQ5
• Protein Sequence: Synthetic peptide located within the following region: KPKKETSKDKKERKQAMQEARQQITTVVLPTLAVVVLLIVVFVYVATRPT
• NCBI: NP_064564
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FN5 antibody, anti C11orf75 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human Fetal Liver tissue using SMCO4 antibody