You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb575568 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SMARCD3 |
| Target | SMARCD3 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SMARCD3 |
| Protein Sequence | Synthetic peptide located within the following region: KRVDIQEALKRPMKQKRKLRLYISNTFNPAKPDAEDSDGSIASWELRVEG |
| UniProt ID | Q6STE5 |
| MW | 55kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | Rsc6p, BAF60C, CRACD3 |
| Research Area | Epigenetics & Chromatin, Neuroscience, Stem Cell & Read more... |
| Note | For research use only |
| NCBI | NP_001003801 |
| Expiration Date | 12 months from date of receipt. |

Sample Type: 293T, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Positive control (+): Human Fetal Heart (HE), Negative control (-): HepG2 Cell Lysate (HG), Antibody concentration: 1 ug/ml.

Rabbit Anti-SMARCD3 antibody, Catalog Number: orb575568, Paraffin Embedded Tissue: Human Lung cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-SMARCD3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate, SMARCD3 is supported by BioGPS gene expression data to be expressed in HEK293T.
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review