SMARCA1 Rabbit Polyclonal Antibody

• Catalog Number: orb576305
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SMARCA1
• Target: SMARCA1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse SMARCA1
• Protein Sequence: Synthetic peptide located within the following region: VAVSDARATVVVVEDEQPGPSTFKEEGAAAAATEGTTATEKGEKKEKITS
• UniProt ID: Q8BS67
• MW: 43kDa
• Tested applications: ChIP, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Sn, Snf2l, 5730494M04Rik
• Note: For research use only
• NCBI: BAC28931

Chromatin Immunoprecipitation (ChIP) Using SMARCA1 antibody - N-terminal region (orb576305) and HCT116 Cells.

WB Suggested Anti-SMARCA1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: NIH/3T3 cell lysate.