You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb578985 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SLCO2B1 |
| Target | SLCO2B1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SLCO2B1 |
| Protein Sequence | Synthetic peptide located within the following region: DPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQ |
| UniProt ID | O94956 |
| MW | 77kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | OATPB, OATP-B, OATP2B1, SLC21A9 |
| Research Area | Cell Biology |
| Note | For research use only |
| NCBI | NP_009187 |

Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Positive control (+): HepG2 (HG), Negative control (-): 293T (2T), Antibody concentration: 3 ug/ml.

Rabbit Anti-SLCO2B1 Antibody, Catalog Number: orb578985, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Membrane in alveolar type I cells, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-SLCO2B1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate. SLCO2B1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.
WB | |
Bovine, Canine, Equine, Rabbit | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review