SLCO2B1 Rabbit Polyclonal Antibody

• Catalog Number: orb578985
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLCO2B1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLCO2B1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 77kDa
• Target: SLCO2B1
• UniProt ID: O94956
• Protein Sequence: Synthetic peptide located within the following region: DPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQ
• NCBI: NP_009187
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: OATPB, OATP-B, OATP2B1, SLC21A9
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Positive control (+): HepG2 (HG), Negative control (-): 293T (2T), Antibody concentration: 3 ug/ml.

Rabbit Anti-SLCO2B1 Antibody, Catalog Number: orb578985, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Membrane in alveolar type I cells, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-SLCO2B1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate. SLCO2B1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.