SLCO1A2 Rabbit Polyclonal Antibody

• Catalog Number: orb330350
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLCO1A2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLCO1A2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 74 kDa
• Target: SLCO1A2
• UniProt ID: P46721
• Protein Sequence: Synthetic peptide located within the following region: VCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTSGNSSAVLGLCDK
• NCBI: AAD52694
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti OATP antibody, anti OATP-A antibody, anti OAT
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Recommended dilution for antibody is 1-3 ug/mL The peptide sequence used for immunization is present in isoforms from 40 kDa to 74 kDa.

Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 1 ug/mL.

Rabbit Anti-SLCO1A2 Antibody, Catalog Number: orb330350, Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver, Observed Staining: Membrane, Cytoplasm in hepatocytes, very strong, moderate tissue distribution, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 -2.0 sec, Protocol located in Reviews and Data.

WB Suggested Anti-SLCO1A2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: PANC1 cell lysate, SLCO1A2 is strongly supported by BioGPS gene expression data to be expressed in Human PANC1 cells.