You have no items in your shopping cart.
SLCO1A2 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SLCO1A2 |
| Target | SLCO1A2 |
| Protein Sequence | Synthetic peptide located within the following region: VCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTSGNSSAVLGLCDK |
| Molecular Weight | 74 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−SLCO1A2 Rabbit Polyclonal Antibody [orb330349]
WB
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μlOATP1 (N286) polyclonal antibody [orb644338]
IHC, WB
Human
Rabbit
Polyclonal
Unconjugated
25 μl, 200 μl, 100 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Recommended dilution for antibody is 1-3 ug/mL The peptide sequence used for immunization is present in isoforms from 40 kDa to 74 kDa.

Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 1 ug/mL.

Rabbit Anti-SLCO1A2 Antibody, Catalog Number: orb330350, Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver, Observed Staining: Membrane, Cytoplasm in hepatocytes, very strong, moderate tissue distribution, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 -2.0 sec, Protocol located in Reviews and Data.

WB Suggested Anti-SLCO1A2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: PANC1 cell lysate, SLCO1A2 is strongly supported by BioGPS gene expression data to be expressed in Human PANC1 cells.
Documents Download
Request a Document
Protocol Information
SLCO1A2 Rabbit Polyclonal Antibody (orb330350)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review







