SLC7A8 Rabbit Polyclonal Antibody

• Catalog Number: orb325105
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC7A8
• Target: SLC7A8
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC7A8
• Protein Sequence: Synthetic peptide located within the following region: PRAIFISIPLVTFVYVFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMA
• UniProt ID: Q9UHI5
• MW: 37kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti LAT2 antibody, anti LPI-PC1 antibody
• Note: For research use only
• NCBI: NP_877392

Sample Type: Fetal Liver Cell lysates, Antibody Dilution: 1.0 ug/mL.

WB Suggested Anti-SLC7A8 Antibody Titration: 1.25 ug/mL, Positive Control: HepG2 cell lysate.