You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325097 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SLC7A7 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SLC7A7 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 56kDa |
Target | SLC7A7 |
UniProt ID | Q9UM01 |
Protein Sequence | Synthetic peptide located within the following region: WGTLVQDIFTYAKVLALIGIVRLGQGASTHFENSFEGSSFAVGDI |
NCBI | NP_003973 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti LAT3 antibody, anti LPI antibody, anti Y+LAT1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of PANC1 cell lysate tissue using SLC7A7 antibody
Western blot analysis of human Fetal Heart tissue using SLC7A7 antibody
Western blot analysis of human Fetal Lung tissue using SLC7A7 antibody
Filter by Rating