Slc7a3 Rabbit Polyclonal Antibody

• Catalog Number: orb578935
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Slc7a3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 67kDa
• Target: Slc7a3
• UniProt ID: P70423
• Protein Sequence: Synthetic peptide located within the following region: RAWSSAFDNLIGNHISRTLKGTILLKMPHVLAEYPDFFALALVLLLTGLL
• NCBI: NP_031541
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Atr, Cat, SLC, CAT3, Atrc3, CAT-3, SLC7A1, SLC7A2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-Slc7a3 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Spleen.