You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb326536 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SLC7A10 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human SLC7A10 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 40kDa |
Target | SLC7A10 |
UniProt ID | Q9NS82 |
Protein Sequence | Synthetic peptide located within the following region: KCVHRLTESMTHWGQELCFVVYPQDAPEEEENGPCPPSLLPATDKPSKPQ |
NCBI | NP_062823.1 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ASC1, asc-1, HASC-1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human ACHN tissue using SLC7A10 antibody
Filter by Rating