SLC7A1 Rabbit Polyclonal Antibody

• Catalog Number: orb578954
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC7A1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Equine, Porcine, Rabbit
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC7A1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 68 kDa
• Target: SLC7A1
• UniProt ID: P30825
• Protein Sequence: Synthetic peptide located within the following region: LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNNDTKEGKPGVGGFMPF
• NCBI: NP_003036
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ERR, ATRC1, CAT-1, HCAT1, REC1L
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The 68 kDa and 66 kDa isoforms contain the peptide sequence and the protein may be glycosylated.

WB Suggested Anti-SLC7A1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate. SLC7A1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

WB Suggested Anti-SLC7A1 antibody Titration: 1 ug/ml, Sample Type: Human 721_B.

WB Suggested Anti-SLC7A1 antibody Titration: 1 ug/ml, Sample Type: Human MDA-MB-435s.