SLC6A2 Rabbit Polyclonal Antibody

• Catalog Number: orb324970
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC6A2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC6A2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 69kDa
• Target: SLC6A2
• UniProt ID: P23975
• Protein Sequence: Synthetic peptide located within the following region: STLSGSTFWAVVFFVMLLALGLDSSMGGMEAVITGLADDFQVLKRHRKLF
• NCBI: NP_001034
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti NAT1 antibody, anti NET antibody, anti NET1 a
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Positive control (+): Human Placenta (PL), Negative control (-): 293T (2T), Antibody concentration: 1 ug/mL.

WB Suggested Anti-SLC6A2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human heart.