Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SLC6A2 Rabbit Polyclonal Antibody

SKU: orb324970

Description

Rabbit polyclonal antibody to SLC6A2

Research Area

Neuroscience

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SLC6A2
TargetSLC6A2
Protein SequenceSynthetic peptide located within the following region: STLSGSTFWAVVFFVMLLALGLDSSMGGMEAVITGLADDFQVLKRHRKLF
Molecular Weight69kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti NAT1 antibody, anti NET antibody, anti NET1 antibody, anti SLC6A5 antibody

Similar Products

  • SLC6A2 Rabbit Polyclonal Antibody [orb324969]

    WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • SLC6A2 Rabbit Polyclonal Antibody [orb1175847]

    ELISA,  WB

    Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • NET1 Rabbit Polyclonal Antibody (BF700) [orb2554121]

    ICC,  IF

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    BF700

    100 μl
  • NET1 Rabbit Polyclonal Antibody (BF700) [orb2401456]

    FC,  ICC,  IF

    Bovine, Canine, Equine, Gallus, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    BF700

    100 μl
  • SLC6A2 Rabbit Polyclonal Antibody (Biotin) [orb2123026]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    Biotin

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SLC6A2 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

SLC6A2 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

SLC6A2 Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

SLC6A2 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/mL.

SLC6A2 Rabbit Polyclonal Antibody

Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

SLC6A2 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5 ug/mL, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

SLC6A2 Rabbit Polyclonal Antibody

Positive control (+): Human Placenta (PL), Negative control (-): 293T (2T), Antibody concentration: 1 ug/mL.

SLC6A2 Rabbit Polyclonal Antibody

WB Suggested Anti-SLC6A2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human heart.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001034

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

SLC6A2 Rabbit Polyclonal Antibody (orb324970)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry