Cart summary

You have no items in your shopping cart.

SLC6A18 Rabbit Polyclonal Antibody (FITC)

SLC6A18 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2119623

DispatchUsually dispatched within 5-10 working days
$ 620.00
Catalog Numberorb2119623
CategoryAntibodies
DescriptionSLC6A18 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsIHC, WB
Predicted ReactivityBovine, Canine, Equine, Human, Mouse, Porcine, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SLC6A18
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW69kDa
UniProt IDQ96N87
Protein SequenceSynthetic peptide located within the following region: MHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDLHMPGAP
NCBINP_872438
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesXtrp2
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.